SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013840 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013840
Domain Number 1 Region: 105-429
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.28e-82
Family NAD kinase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013840   Gene: ENSTNIG00000010910   Transcript: ENSTNIT00000014035
Sequence length 437
Comment pep:novel chromosome:TETRAODON8:Un_random:3161247:3167601:-1 gene:ENSTNIG00000010910 transcript:ENSTNIT00000014035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCQVCVMAGVKEVRVEAPPYCCSTCEGEEVACGNLARRRRKTRSLSTSSASSSSSEYRR
TQSLHGPSPVTTFGPKACMLQVPQAVMHIQDPASQKLTWNTPPKSVLVIKKIQDASLLEP
FKELCIFLAKVKNMIVYVEKKVLEDPAISSNENFGAITKGFCTFREDLDNISNLVDFIIC
LGGDGTLLYASSLFESVPPVMAFHLGSLGFLTPFKFDTYQSQVTQVIEGAPPLAARDRLK
VRVLKENREKKARVDELGAIWTNGDVEGSRRVAQYQQVLNEVVVDRGPSSYLSNVDLFLD
GHLITTVQGDGLIVSTPTGSTAYAVAAGASMIHPNVPAIMIPPICPHSLSFRPIVVPAGV
ELKIMLSCDARNTAWVSFDGRKRQEICHGDSITITTSCFPVPSICFRDPVNDWFESLAQC
LHWNVRKKQNYLSSEDE
Download sequence
Identical sequences H3D004
ENSTNIP00000013840 99883.ENSTNIP00000013840 ENSTNIP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]