SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014058 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014058
Domain Number 1 Region: 412-627
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-38
Family DBL homology domain (DH-domain) 0.00083
Further Details:      
 
Domain Number 2 Region: 781-980
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-31
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 615-732
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014058   Gene: ENSTNIG00000011123   Transcript: ENSTNIT00000014254
Sequence length 982
Comment pep:novel chromosome:TETRAODON8:11:2035371:2053812:-1 gene:ENSTNIG00000011123 transcript:ENSTNIT00000014254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSEGENFLALDRKTVVTRSRSYSGKISGYVPETVPEETGTEFQTHDYCATALDSANEASD
LSQQPGVNTSIPSIKSRRFMLYSRSAEGPDLSLTSPTEIGLSLNDDLRMKRKDDNLSLPC
VMSSSGSFSQRSHQSSSGVSTPTSLVDIPPPFELAYIVKRPVTKSSPSLLIHHEHNDINK
KKKSSFKRFLALKFKKKSDSKSFSDGSVRSSRSSSESSHHGPGRVIELDRRSASGSPRLQ
PNMVNPRQGAADVPSAFVHHHRRKSYGRGVSRVESFEERSRRSTRPLPLTKPRSISFPSA
DTSDYENIPAMSSDYENIQIPGRPTRSHTVTEFFEDTSHAAVPCNENDGYVDMNSFPGID
SKPQASKADAESAYTEPFPVNSISAVPSGDEDHGRTSEEEEGAGEPSCDRQIDGRSRAFY
VAKDLVDSERLHVSVLKHLQEDFRSAVMEAEGEEGEPVLEEQQLGEILGVLPQVYALHSS
ILTELEERISQWEENQSMVDVILSRREDFRVFDTYISEYDRSMCLLEESCRDNLAFASVV
KKFEKRSLDGAEVPLKHQLLQIIVRVLQYRMLLTDYLNNLSPDSKEYEDTQAALVIVSEV
SDQASDNLKQGENLLRLVHIEYSVKGKRDLLKAGRMFVKEGTLMKVLKKSRLPRHLFLMN
DIMLYTYPQQDGKYMLKNTLSLSGMKVSKPVIDDVLNCLRIEVSDITITLSAGSVGERED
WFHTLSRAIADHAAGLCTFGGPCSEAREKLWMALGEAAPVLVPVSHVMTCMNCTTDFSLT
LRRHHCNACGKVVCRACSRNRYPLKYLKDRVAKVCDHCYGELRKKGRMSVGGSVSVACSN
PSPQTHRASRPLSAVFQSLQPPSLWKNKKCSPSLTQVALAVEGSTMSGSLQRRKKSKRKW
KRLWFLLKDKVLYTFTAREDKVASESLPLQGFTVKLTERPEGEESSSVFQLYHKKTLYYT
FRADDQHTARRWVNAMEEATVL
Download sequence
Identical sequences H3D0M2
ENSTNIP00000014058 ENSTNIP00000014058 99883.ENSTNIP00000014058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]