SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014183 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014183
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000791
Family Ankyrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014183   Gene: ENSTNIG00000011244   Transcript: ENSTNIT00000014380
Sequence length 987
Comment pep:novel chromosome:TETRAODON8:Un_random:17849455:17871297:-1 gene:ENSTNIG00000011244 transcript:ENSTNIT00000014380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQLYYKKAIYSPYRDRIPLQIVRAEVELSAEERAYLTAVEKGDYAGVKHALREAEVYYN
IDVNCLDPLGRSALLIAIENENLEIMELLLDHGIHTGDALLYAIRKEVVGAVELLLSHRR
PSGEKQVPSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQE
YEELSQQCKRFAKDLLDQARSSRELETILNHRDDQSEELDPRQCHDLAKLKLAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVTCFIIGLLFPVFSLIYLLAPKSALGNFI
KKPFIKFICHTASYLTFLFLLLLASQHIARTNLHMQGPPPTVVEWMILPWVLGFIWAEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSRPREEWEMWHPTLIAEA
LFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETKASEEHNNCKGIRCERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFI
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIVPSPKSIWYLLMWLHNKLCRRGQPPGDDTHKCENLREFTERHADSLIQNQHYQEVIR
NLVKRYVAAMIRSAKTDEGLTEENFKELKQDISSFRYEVLDLLGNRRPPRRHYSSSSETT
REDGAMEEDSESGDSCGGGGQKAKGVTFMTPLEDDSRPSPKLGVSALVRSISGMTQVEKG
RLSTPGGKADSFKRLSYLFSRSKRKAPPVPLPLQSPSSYTISDGLLHPLGSHSHSDFRLS
DVTRSETHLNEVGHSGNIDIPSYSPLRTNGRDTLLTLPLPPPCPCQSLHCASNMSESSSR
LLDSSEDVFQGGGDSCDVIEDSVTTQL
Download sequence
Identical sequences H3D0Z7
99883.ENSTNIP00000014183 ENSTNIP00000014183 ENSTNIP00000014183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]