SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014266 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014266
Domain Number 1 Region: 424-670
Classification Level Classification E-value
Superfamily vWA-like 9.78e-67
Family Trunk domain of Sec23/24 0.0000961
Further Details:      
 
Domain Number 2 Region: 170-441
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.68e-39
Family beta-sandwich domain of Sec23/24 0.0055
Further Details:      
 
Domain Number 3 Region: 672-767
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.22e-35
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 4 Region: 874-1015
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.54e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.00098
Further Details:      
 
Domain Number 5 Region: 768-873
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.45e-28
Family Helical domain of Sec23/24 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014266   Gene: ENSTNIG00000011323   Transcript: ENSTNIT00000014464
Sequence length 1019
Comment pep:novel chromosome:TETRAODON8:Un_random:11942853:11949092:1 gene:ENSTNIG00000011323 transcript:ENSTNIT00000014464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVAAPPYSQAQPRLGGYQGGFGPGPAQPMNGHYGGPPQAFTAPPTGAVKPPVSSV
GMSPPPPSSPFSANVHHNRPQSYPAPPTAPAAYGQPPYSTVASQAPPQTQHLTNQMSALS
LGSYGQFHGAPARGPPQSVAQQPFQMPPPPANMAMGKPTAQMAGPPMAGPPMAGPPMGGI
GSPFPGPSPPGGPGGFQQPGPGAAVPPGYPHPAGPFGGPMAGPQQGMPGAFPGAPGGLAG
PPQKKLDPDSIPSTTQVIEDDQAKHGAQVYATNLRGQVPPLVTTNFTVQDQGNASPRFMR
CTTYSLPCTSDLAKQCQVPLAAIITPFAALPKNEAPLYVVNHGESGPIRCNRCKAYMCPY
MQFLDGGRRYQCSFCNCVNEVPVFYFQHLDHMGRRVDFYERPELSLGSYEFVATLDYCKN
NKPPNPPAYIFMIDVSYSNIKSGLVKLICGELKTLLQNLPREDGADGSAVKVGFVTYNKI
LHFYNVKSALAQPQMMVVSDTAEMFVPLLDGFLVSYQESRAVISNLLDQIPDMFADTGES
ETVFAPVIQAGVEAFKAAECSGKLFIFHSSMPTAEAPGKLKNRDDKKLLNTDKEKTLFQP
QKGVYEQLSKECVAQGCCVDLFLFPSQYADVATMADVPSHTGGSVYKYNNFQVDVDGEHF
LRDLRKDVQKSIGFDAIMRVRTSTGFRATDFFGAIHMNNTTDMEMAAVDCDKAVTVELKH
DDALNEEAGALLQCALLYTTVGGQRRLRIHNLSLNCSSQLSELYKSCETDALINFFAKSA
YRAILNQPVKNVREILVNQTAHMLACYRKNCASPSAASQLILPDAMKVFPVYMNSLMKTA
PLVGSAELSTDDRAHQRLAVMAMGVEETQLLLYPRLIPLHNMDVSAEAPPTPLRCSEERL
ADAGVFLLENGHSMFLWLGQASPPDLIQNLFNMPSLAHLQANMSVLPDLDNPLSKKVRGI
ISGLLEKRPSSMKLQIVRQKDRPEMLFRQFLVEDKGLHGGASYMDFLCYIHREVRQLLT
Download sequence
Identical sequences H3D180
ENSTNIP00000014266 99883.ENSTNIP00000014266 ENSTNIP00000014266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]