SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014492 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014492
Domain Number 1 Region: 428-672,706-775
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.16e-49
Family Diacylglycerol kinase-like 0.012
Further Details:      
 
Domain Number 2 Region: 4-91,150-177
Classification Level Classification E-value
Superfamily EF-hand 1.09e-40
Family EF-hand modules in multidomain proteins 0.0048
Further Details:      
 
Domain Number 3 Region: 155-241
Classification Level Classification E-value
Superfamily EF-hand 3.31e-20
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 4 Region: 250-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0032
Further Details:      
 
Domain Number 5 Region: 320-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014492   Gene: ENSTNIG00000011542   Transcript: ENSTNIT00000014691
Sequence length 795
Comment pep:novel chromosome:TETRAODON8:2:9065424:9093265:1 gene:ENSTNIG00000011542 transcript:ENSTNIT00000014691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRSWVCLSPAEFAQLQQYSEYSSKKLKDVLDEFHGEGILSKYNPEQPIDYEGFQLFMA
TYLENDIPEELCQHLFTSFKSKTGGCSSDQSHAETSLLGRPSCTAGFHNKFNKTMTEVAC
APITERSQSEKHLLQRRSPSPHNSPLLQPPQVVFLKDIVCYLSLLERGMPEDKLEFMFRL
YDTDGNGLLDSSELDRIINQMVHVAEYLEWDTTELRPILKEMMEEIDYDRDGTVTLEEWI
RGGLTTIPLLVLLGMDTNIEEDGQHVWRLKHFNKPAYCNYCHTMLLGVRKQGLCCSICKY
TVHERCVSKDIAVCISTYAKSRRHTDAMQHVWMEGNSPTKCDRCHRSIKCYQGLTGLHCV
WCQITLHNKCASHVKQECDGGALRDHTLLPSYICPVILVRISPDACQTIAYILHREYRRI
NPLPGSHPLLVMVNPKSGGRQGERVLRKFKYLLNPRQVYSLERGGPMMGLSFFHDVPDFR
VLACGGDGTVGWILDCIVDTDKSNFAKHPPVAILPLGTGNDLARCLRWGGGYEGGSLLKF
LRDIEHSTEVVLDRWNIDIIPDDKEEKGVSIGVYTMEQMNVSIEMKKDASIAHRFHLMRE
KHPEKFNSRMKNKLWYFEFGTTETISATCKKLNECIEVECDGTTLDLSNTSLEGIAVLNI
PSMHGGSNLWGESKKRRNYNRMSKKALDRIPSSTVTDAKELKFCVQDISDQLLEVVGLEG
AIEMGQIYTGLKSAGRRLAQCASVSISTTRQLPMQIDGEPWMQPPCTVRITHKNQVPILL
GPPQKTPFFFFKKRN
Download sequence
Identical sequences H3D1V4
99883.ENSTNIP00000014492 ENSTNIP00000014492 ENSTNIP00000014492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]