SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014544 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014544
Domain Number 1 Region: 7-205
Classification Level Classification E-value
Superfamily E set domains 5.83e-78
Family RhoGDI-like 0.0000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014544   Gene: ENSTNIG00000011594   Transcript: ENSTNIT00000014743
Sequence length 205
Comment pep:novel chromosome:TETRAODON8:Un_random:6942663:6943934:-1 gene:ENSTNIG00000011594 transcript:ENSTNIT00000014743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTPEQLAAMAAEIKEDECQVNYKPPAQKSLQEIQELDKDDESLRKYKETLLGNVS
TLTDPKLPNVQVTKMTLVCDTAPGPLVLDLQGDLDSFKKNPFVLKEGVEYKIKISFKVNK
EIVSGLKYVQQTFRKGVKVDKTDYMVGSYGPRPAEEYDYLTTAEEAPKGMLARGTYNIKS
KFTDDDKHDHLSWEWSLTIKKDWKD
Download sequence
Identical sequences Q4S9L2
ENSTNIP00000014544 99883.ENSTNIP00000014544 ENSTNIP00000014544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]