SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014582 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014582
Domain Number 1 Region: 329-529
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.0000701
Further Details:      
 
Domain Number 2 Region: 223-296
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-17
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 110-204
Classification Level Classification E-value
Superfamily PX domain 0.00000000275
Family PX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014582   Gene: ENSTNIG00000011630   Transcript: ENSTNIT00000014781
Sequence length 1603
Comment pep:novel chromosome:TETRAODON8:7:1181045:1205769:-1 gene:ENSTNIG00000011630 transcript:ENSTNIT00000014781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLRPGRHLDDDDVPGLAHIHPRERPDWEETISAMARSAEIPELRAEPLMRSCSSSTASM
KVKNVKRLSFTKGHFPKLAECAHFHYENVDFGTLQLSLGDEQCEATRNGYESKELVYLVH
IHCQGRSWIVKRTYEDFRVLDKHLHLCIYDRRFSKLPELPRLDSLTDQSESVSQMLLAYL
SRFSAIADNKINCGPALTWMEVDNKGNRLLVHEESSINVPAIAAAHVIKRYIAQASDELS
FEVGDIVSVIDMPPKEDTTWWRGKHGFQVGFFPSECVELINDKVPQSMTNTVPKPVSKKH
GKLITFLRTFMKSRPTKQKLKQRGILRERVFGCDLGEHLLNSGHDVPQVLKSCTEFIEKH
GVVDGIYRLSGIASNIQKLRHEFDSEQIPDLTKDVYIQDIHMCGLRCVSSTSGSCHNPLL
TYQLYEKFYDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSRLAAFSYVTNMHS
KNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNNVDVLFSPKLSSLIREG
AGHNSLSRPKSLLISSPSTKLLSLEEAQARTQAQINSPVTEDSKYIEVGEGPAALQGKFH
TVIEFPTERKRPPSKSKKSPVGSWRSFFNLGKSSAMSKRKLHRNPSEPNELKAMALAGSR
GETATLRSAKSEESLSSLHNVEGESKVYRPRRPRSSSDALSASFNGELLDSRLHCNSYDN
LEPTEDSDADEGPICVPALISPPRSAGEDVDLSPPDIGMATLDFDPMSFQCSLPDTTYAF
PKDDCPPGAEGSVLKKSPSSVCCNANGSDLISTTFVGSLTSPLSFPEVNRAAEERPQNKK
ATAPFPCTEKPTQAVSPIKCTKNTSLTPFWSQEPLSAETHTVPPSAAKDSSAPTGGALPR
AGEPSLSEAFQMELQSKLAAFDSAENRHPKEGGSTEQTKAASGQDQREWCPSLLLGCFSF
VSPIGVEDLDSSQNAARLLALTLAESAQQAPVQTQSSGLCTPQSPPSSQGAAHFQEAPQT
LFKISPECPIPSSPTVKQPPLDLPTSVVQSSGDTTCSTHTEPGSALSDPPQGPGSPGLAS
PTRKAPEQQQQQQQGFTGQIPVQTSHAPASHPSGHCRDSEVLSKPEVKLVSLSPEVNVND
RIGRNQNRENCGVCRASQAARPAPSIHSETQAASSVAPAAAETRPVPELPPLRPSMQKSP
GRRRTQPSKYHDPCGSVPPPPPVRTIESKLATAALSQSEASYHVLPERPLPDRPEDAPPN
PPLSPHKPSMHQPNYQYHPVAESILIEPPGSGYYYQRPVSLGPPSAPHQCRPDVGVPPHL
SFVSKSEPQIPYVARADTRYSTLGPRSYHHSIKSRGSPRGAYMSAGYQGYSHDRPHGYPT
IRRVHSLHVPSTIRSVPVQRTEVPPDDELFLYHRPIHQCKAYQQSSQAEYHVTQLQPYFE
NGRVQYRYSPYAGASPSELSYYDIDPYGTIRVRAHHSFGRDPPVGRPGGKATGYHYLAHH
VLPLGKEHSFVSRDMPPGHGTKEATYLAWDPEESERFRMHSIRRESRARQKVKGPVLSQY
DNVGLFAPADVSGYETQHLRSKSDPGKTAPAAAESKDGRYQPR
Download sequence
Identical sequences H3D244
ENSTNIP00000014582 ENSTNIP00000014582 99883.ENSTNIP00000014582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]