SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015601 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015601
Domain Number 1 Region: 97-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0046
Further Details:      
 
Domain Number 2 Region: 243-357
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-22
Family Ypt/Rab-GAP domain of gyp1p 0.014
Further Details:      
 
Domain Number 3 Region: 481-546
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-19
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 4 Region: 567-599,633-721
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000000471
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015601   Gene: ENSTNIG00000012629   Transcript: ENSTNIT00000015808
Sequence length 755
Comment pep:novel chromosome:TETRAODON8:3:8749692:8754014:1 gene:ENSTNIG00000012629 transcript:ENSTNIT00000015808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGTYTPAPGGPFSALTPSMWPQDILARYHQKDPTEQSELQYDEFGFRVSADGGGKSKSW
LGTNGSPQREDPQQRLRWQAHLEFTHNHTVGDLTWDLIEPVLARSERLHTLVLGGIPHSM
RPQLWMRLSGALQKKRTSEISYREIIKNSSNEDTTVAKQIEKDLLRTMPSNACFSSLTSV
GVPRLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSS
TLLGIQTDQRVLRQLIVQYLPALDRLLQEHDIELSLITLHWFLTSFASVVDIRLLLRIWD
LLFYQGSLVLFQITLGMLKIQEEELISSENSASIFNTLSDLPSQLRDGAELLGEAMRLAG
TLSQETLEAQRHKHLSYLLSEQTQLNNGSSVPLNTNLNKVVRRQSLHRRSTLSSLLFGED
EADSLKSKNIKQTELVAALREAIAHTAEHFHCLDPHHSSTDLTPDYSMESHQRDHENFLV
VSRNRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEI
LDERSKEYSLAGDDSVTEAVTDLVRGALCPALKAIFQHGLKKPSILGGPCHPWLFIEEAA
SREVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDLAHAQMDIKFRS
LVCVGLNEQVLHLWLEVLCSSVAAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD
CELPEKKEEKEQRPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences H3D512
ENSTNIP00000015601 99883.ENSTNIP00000015601 ENSTNIP00000015601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]