SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015852 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015852
Domain Number 1 Region: 65-257
Classification Level Classification E-value
Superfamily Sec7 domain 4.71e-80
Family Sec7 domain 0.00000000954
Further Details:      
 
Domain Number 2 Region: 265-387
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-29
Family Pleckstrin-homology domain (PH domain) 0.000000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015852   Gene: ENSTNIG00000012876   Transcript: ENSTNIT00000016062
Sequence length 401
Comment pep:novel chromosome:TETRAODON8:2:6306738:6316119:-1 gene:ENSTNIG00000012876 transcript:ENSTNIT00000016062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEAGDASGGAVFPEDLSLEERDELSNIRRRKRELLDDIERLKFEIAEVMTEIEQLTCIG
DSKTSQRNKQIAMGRKKFNMDPKKGIQFLLENDLLQQTPEDIAQFLYKGEGLNKTVIGDY
LGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQC
NPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEELLRNL
YDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGTGGRVKTWKRRWILTDNCLYYFEY
TTDKEPRGIIPLENLSIREVDEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVY
RISAPTPEEKEEWIKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences H3CFL1
ENSTNIP00000015852 ENSTNIP00000007038 99883.ENSTNIP00000007038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]