SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016005 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016005
Domain Number 1 Region: 437-688
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-43
Family YWTD domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 1-254
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-23
Family YWTD domain 0.00072
Further Details:      
 
Domain Number 3 Region: 349-426,685-735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 307-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000233
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 881-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000594
Family EGF-type module 0.00084
Further Details:      
 
Domain Number 6 Region: 269-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000321
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016005
Domain Number - Region: 793-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000225
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016005   Gene: ENSTNIG00000013026   Transcript: ENSTNIT00000016216
Sequence length 967
Comment pep:novel chromosome:TETRAODON8:20:1863986:1870184:-1 gene:ENSTNIG00000013026 transcript:ENSTNIT00000016216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLFGHGKAIHRMDLDGKNQRRLVAGVGRSIFLDFHFRDDTIYWADKQTGVIYKAAVREA
QRQKLCSDKHISGLAVDWIWKIYSGRVKKRGELGKLMSTEKNEVTLVRHLTQPSAITVDP
IDRFLFWLSGDTFPSIQRSYVTGQKKTTLIKMTVQVKALTIDRQEKRLFWVQFGLQGESA
VASCDYNGNTLHILDVPLEVHSGISVFLQNIYYTDDTFRVIKQMNKHSGGEALNINLKPM
AKPPVDIKVVHHLNQPMEDSSFPGYNSCCDIQSGNCVSVCSSLAEHGKCQCSEGFALSKQ
GTHCEADVNECALWNHGCSLGCENIPGSYFCTCPKGYALLPDRKTCKEIVPCEGNIKCGH
GCLQTDEGAICVCPEGSLLQEDGHVCTGCMSPDRGGCSQLCTSVTLTGWQCGCLPGYHLH
HDGKRCIASGLSGPPSFLLVANLVDVRQINPGGSGNQILLEEPKGAIIALDYDPVENKVY
FASTSQKTIERIDFHGGSREVLVTDVLDSPEGLAIDWVHRKMYWTDKSQAAVSCSTLAGL
NRQTVVSKALEKPRGIAVHPSEKKLFWTDIGAQPVVESASLEGKSRVIVASTNLVSPSGL
TIDFTEDRLFWCDLRRGVVETAALDGSHRQVLLDNQVGRPFDLAVFEDRLWISDQEHQQL
RSVHKRTGKNLQNILGLLQPASIVVVHPLAKPGADVCLHMNGGCSQICENKLGFAHCSCL
PSSTLAVDGKSCLPDSTGTESTQLTSLENKLGDENTPQTTPGFSTHKTEADFDINNGKST
FTDKMVSGKAFPNQHDCDSLRCDVNAQCLLNGGSPGCSCLEGFTGDGLLCVGEYFCCISR
SKGTTVNMLGTDHEESEAGLPNLPTSPPRDVITGTHSSNSESCPSTHQNYCLYGGVCFYF
PEMDSYACNCVAGYIGERCQFSDLEWWDLQQAEEEKKKNVLIAACVLILGSLLCVAACLA
YCYRSEK
Download sequence
Identical sequences H3D665
ENSTNIP00000016005 99883.ENSTNIP00000016005 ENSTNIP00000016005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]