SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016099 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016099
Domain Number 1 Region: 295-482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-60
Family SPRY domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-19
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.63e-19
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016099   Gene: ENSTNIG00000013117   Transcript: ENSTNIT00000016310
Sequence length 484
Comment pep:novel chromosome:TETRAODON8:1:7089604:7093392:1 gene:ENSTNIG00000013117 transcript:ENSTNIT00000016310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASALEELQSELTCPVCLELFRDPVILDCGHHFCKVCIIQCWEAIEVSNCPKCRKSCE
RKLRPNSLLCNVVESVRKARTADAVPAGHWPRMGLDMCEEHEEKLKLYCEDDQLPICLVC
GMSRDHKNHNVIPINEAFENYKDKLSIALERVEVQTEEATRFRAQTNEKILLIKERAGDQ
EELVTAEFVRLREFLQEEEERIKEKLQKQKEEKLHQLEEALTQTTEQISRLENTAEQLRL
KLREEENPEQLKGIKDFIGGAESLFDCPPEVDVTLHSAEFLGPLQYRTWRKMSSIFQPAV
SGVRLDPDTAYPCLWVSPCRTRVQVGKLQPNLPNNPERFTRYNIVLGAEAFSSGRHYWEV
EVGSKTAWGLGVVLASVNRKEEISLCPEDGFWTLVLRDKCDGSSEYEACTDAEENLIHPA
KPPRRVGIYLDYNHGEVAFYDAADMSHLFTFYDANFKEPVYPYFNPWPIINGHNLEPLTV
VTPY
Download sequence
Identical sequences H3D6F9
ENSTNIP00000016099 99883.ENSTNIP00000016099 ENSTNIP00000016099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]