SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016343 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016343
Domain Number 1 Region: 113-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-29
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-22
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016343   Gene: ENSTNIG00000013353   Transcript: ENSTNIT00000016556
Sequence length 507
Comment pep:novel chromosome:TETRAODON8:17:7725975:7732956:-1 gene:ENSTNIG00000013353 transcript:ENSTNIT00000016556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCYWYIRPGRGIIELDFSYVNIEYHSSCIYDAVYVYDGSSSSSRLLGRLCGSQRATFYST
GAYLTVYFKSDNSVTYQGFRANYQVTTTTVFIFYFFKCSCLSINSGAPCGGYLYGSNDTF
YSPNYPNSYPNYASCYWYIRPGRGIIELDFSYVNIEYHSSCGYDAVYVYDGYSSSSRLLG
RLCGSQRATFYSTGAYLTVYFSSNYIGTYQGFRANYQVVSIKSSNINNSHCNSANMTIVI
STFYLNSLGYDGSNVYLDDPLCRPQFSKYNVTFSFPIDSCGNVKTFEDGRTVYTNSLRAY
PTTYGEITRQDHLKLLVGCRMEQDSVSQIMYRVEHRDNSSITGSGRYATLMHFYTSSSFS
YKTQVTQVPYEVLLNQELFVQVEMENKDRSLVVFIDTCLASPSPHDFQTRAYYLVRNGCG
ADSTYKAYASGFNNYARFSFKAFQFLRATESVYLQCKVLICQASDANSRCRRGCSRRKTR
DLQAQHDSQTLVTGPIQLKGFKKKDKE
Download sequence
Identical sequences H3D753
ENSTNIP00000016344 99883.ENSTNIP00000016344 ENSTNIP00000016343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]