SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016904 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016904
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily E set domains 0.00000134
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016904   Gene: ENSTNIG00000013899   Transcript: ENSTNIT00000017118
Sequence length 436
Comment pep:novel chromosome:TETRAODON8:2:11594868:11596663:-1 gene:ENSTNIG00000013899 transcript:ENSTNIT00000017118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEEQLEVLVQMHDFHGRPKRYGGDFLLARLHSPELGAGVAGRVLDHRNGFYSALFPLLWV
GPAQVEVTLVHPSEAVAVLQRLREERSDRVFFQSLFRLGSLSETTLCNMCLPPDEHPLCN
YTDPHTGEPWYCYKPRMLSCDTRVNHAKGGYLKHLVSSKEALLFQRCVSSTPPPRCVSLS
HTSFRSPSQSFLSVKPDAVPLGTSGFYYRGSWRPLDGTSMHQFNGSSAVVRCLRNKVVDM
FGDSTVRQWFEHLIASVAELKEFNLHSPKNVGPFMAVDSAHNILVRYRCHGPPIRFSTVS
ASELRYISNELDALSGGPDTVVVLSVWAHFSTFPVEVYIRACHIRRALVRLLNRAPDTAV
VIRSANLQALDQDNSLYNSDWFSLQLDQALRSMFGRLDVLLLDAWQMSLAHHLPHALHPH
PPIIKNMVDMLLSYVC
Download sequence
Identical sequences H3D8R3
99883.ENSTNIP00000016904 ENSTNIP00000016904 ENSTNIP00000016904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]