SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016955 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016955
Domain Number 1 Region: 307-590
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-54
Family Kelch motif 0.00027
Further Details:      
 
Domain Number 2 Region: 40-155
Classification Level Classification E-value
Superfamily POZ domain 1.33e-32
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016955   Gene: ENSTNIG00000013950   Transcript: ENSTNIT00000017169
Sequence length 608
Comment pep:novel chromosome:TETRAODON8:2:12466862:12469944:1 gene:ENSTNIG00000013950 transcript:ENSTNIT00000017169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLERTTDCPLSDHAGASSPEEDTENLSDVNELHWEDGGLLADLQKGMETLRERRELT
DVVLCVQGHDFPCHRVVLAAASQYFRAMFCNGLRESHEERVEIKGLDSETMSVLLDYTYT
SRAHLTHSNVQRILEAASQFQFLRVVDACAGFLSKSLHLESCIGILNLADSHVLTSLKTG
AQDYIVSQFSQVVQQRDFLELPADSLESVLQRDDLDASCEERVFEALTSWVRARQEERSP
LLARLLSHVRLPLLEPAYFVEKVEADELIRSCAEAFPLLQEVRRYHLTGSGVVSERTKPR
VHHFLSEVFLIIGGCTKDDHFISSVTCLDPLRRSRLDVARLPITEMEDESQNRKWVEFAC
VTFCNEVYISGGKDTQNEVWKYNGALDKWIQVDSLKTGRWRHKMVAHGGKVYVLGGFEGV
QRLASVEAYDPFHNCWTQASPLAVAVSSFAAATFDRWIYVIGGGPNGKLATDQVQRWEPG
TDSWEMRAPIPVETKCTSAVTFNSCIYVVGGAMHAMYCYSPLCDSWSLITRLGERASCAI
AACNNKLFITGGRDNKNQVISTVMCWDVDRAVLTEECILPMGVSHHGSVTLMKSYTHIHK
VMASSEAK
Download sequence
Identical sequences H3D8W4
ENSTNIP00000016955 ENSTNIP00000016955 99883.ENSTNIP00000016955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]