SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017394 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017394
Domain Number 1 Region: 759-1007
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-43
Family YWTD domain 0.000014
Further Details:      
 
Domain Number 2 Region: 92-252,346-626
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 8.11e-43
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 
Domain Number 3 Region: 1558-1741
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-33
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 1952-2109
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-17
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 5 Region: 1416-1454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000864
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 6 Region: 1323-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1196-1231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 1074-1113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 9 Region: 1152-1193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 10 Region: 1368-1403
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 11 Region: 1469-1507
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 1115-1154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1238-1271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 14 Region: 1274-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000942
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 15 Region: 1513-1548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000055
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 16 Region: 1756-1931
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000378
Family Fibronectin type III 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017394
Domain Number - Region: 1017-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017394   Gene: ENSTNIG00000014377   Transcript: ENSTNIT00000017612
Sequence length 2219
Comment pep:novel chromosome:TETRAODON8:16:8213121:8226265:1 gene:ENSTNIG00000014377 transcript:ENSTNIT00000017612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRRPAAPQPPARSALCLLLLLCVSGSRSSNLHLRAGPARPQNRGFFTVDAIADPAGGD
GAARAAAGGAYPPRRSPRSSGESAMPKVYGQANLNDSHNQMVVHWAGEKSNVIVALARDS
TGSTGPKSSSVYVSYDYGASFTQVSDKFRPPADGTGAEDTPVISQFYHSPADNKRYLFVD
SGSRVLWSSLDFCRSVRSFRLPFRPSDLLLHSRRPNLVLGYDAAHPSKQLWKSDDFGETW
VLIQEHVKTYFWGVEPYDPPTTVLVQRSEPQGVSTVLSSTDFFQSQRNRRVILERADSFQ
LRDRYLFATTTQKLPGSQEPSSVQLWVSYNRQPMRAAQFMTRHPITEYYIADASEDQVFV
CVNHLNNVTHLYISDAQGLSFSLSLEDVLYYSPEGSGSNTLIRYFASEPFADLHRVEGLR
GVFIATLVNGSASEDNMRSVITFDKGGTWELLQAPTADSLGGTMDCQLSQGCSLHLAQRW
SQLFNIQLRRMPILSKDSAPGLIMATGSVGRSLANKPNVYVSSSAGARWREALAGPHFYT
WGDHGGLLMAVPQGGATTHLKFSTNEGETWTDFRFSQREVLVYQLLTEPGEKSAVFTVFG
SYADQRHSWLILQVNASDVLGVPCSEADYKRWSPSDEHGNGCLLGREVTFKRRAPHATCF
NGEEFDRPVGVSNCSCTRQDYECDYGFKLSEDLSLQVCVPDPEFTGDLDAPPLPCPVGSA
YRRSKGYRKVPGDSCSGGDVESRLDGEMLPCPVGESTEFILYAVRNAVHRYDLATGQDQP
LPLGGLREAVALDFDYDRNCLYWADISLDTIQRLCLNGSSGQEVVVRKDLQNVEALAFDP
VSRLLYWVDAGARRIEVSNSEGDMRHTLLNASVLEHPRALVLIPGESLMFWTDWGDRVAG
VYRAYMDGTNVSCIASDGVRWPNGITADERWLYWTEAFSDRIERADFTGGRRSVLLEGLP
HPYAIAVFKGELYWDDWSKMGIFKAPKAGSQSGELLVGGLTGVMDLKIFYRGKNRGHNAC
VDQPCSHLCLPRPAHRHTCVCPDGAPSAATAPSGELQCQCPSGYRLQNKTCVKTEHSCLP
NQYRCSNGRCISSIWKCDSDNDCGDMSDEQECPTTTCDPSNQFRCVASGSCVPLAFKCDH
EDDCGDNSDEEHCESHQCGPGEFTCARGVCVREAWRCDGDNDCRDWSDEANCTAGHHTCE
ANSFQCHTGHCIPQRWMCDGDDDCQDGSDEELRYCGPQCHGFLCSNHTCLPATAHCNGVQ
ECPDGADEQNCEPLCTRYMEFVCRNRAQCLFRSLVCDGIKHCEDGSDEDAEYAGCAVPSE
FGKVCDAYTFQCANGVCVSLEWKCDGMDDCGDYSDEANCAAPTDVPGCSRYFQYECKNGR
CIPTWWKCDGENDCGDWSDETQCTGGATPHTAAPGPSTCAPNRFRCGSGACVVDSWVCDG
YADCPDGSDELGCPTAAPALTPMPPRPPDRCGRGQFLCRRPPVCIPDWQRCDGRPHCRDG
SDEARCPTRGPLFCPNGTRCSDGEACVPDSERCDGFLDCSDRSDEDNCTGETQTFKVQNL
QWTPDFSGAVTLTWSRPKNLPLDSCSFLVYYRLVGTQQWTTMDTHSNKATYRLTVLQPDT
TYQVKVLTQCLSRTHKSNELITLRTPEGLPDPPRNLQLSCDRGEDGKVDVSWSPPDKTHG
LIREYIVEFSEKGGLEWTSHRCSATQLEVKDLQPDTLYRFRVAAVTSRGVGNWSEVKSIT
PIKGQLFLLPPVVADAIATDSMSLSFSFNSQYEVQQYVVILSWQFDSHVKESRNFTVAEK
FLSGNRLLQTLQLTAGTVYEVAVWARTAIGDSPTALSHHRTGGVQPQRPLLKSRPLNQTA
VECSWTAGGATVQTYGVFYATSFLDLYRSPRQLSAASLSLTVVVDSPEQYLFLVRATAPF
LGPPSELSVVKMIPNARCRPGTSNRVRAEKMQALLKWQPPYDSPDEPLMYAIHVRDAVRK
TERDYKVTTQNNTVEYLLRGLEPGGRYSVSVRLRNMSKEASFSLSTVPLPAPEALKILTE
DDHVFLFWKSLAVREKGFDEARGYEVHVYDSTTNQTSYLGNTTETYLRVSSLQPGHNYTF
SVQARCLVGGQLCGEAALLLYDQLTAEGGDAAGSGQRSGDMAAVVVPVLFMLLLGVCGGL
VILYLRHRRLQNNFTAFANSHYNSRLGSAIFSSGDELGDDDEDAPMISGFSDDVPMVIA
Download sequence
Identical sequences H3DA53
ENSTNIP00000017394 ENSTNIP00000017394 99883.ENSTNIP00000017394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]