SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017986 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017986
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-44
Family RUN domain 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017986   Gene: ENSTNIG00000014939   Transcript: ENSTNIT00000018210
Sequence length 433
Comment pep:novel chromosome:TETRAODON8:3:14067244:14074841:-1 gene:ENSTNIG00000014939 transcript:ENSTNIT00000018210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGCIQTAMAMGLTSKKASARSVGVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEHILSHRFKGSGSWFGSDGQRSFWEYVRLACGKVQNNCIASIENIENISTSRAKG
RAWIRVALMEKRLSEYISTALRDTRTTRRFYDEGAIMLREEATVLTGMLIGLSAIDFSFC
LKGEALDGKSPAVIDYTPYLKFTQSYDYLSDEDDRRSVDSSISEESVPEHPYIPLVTDEE
SWSNKCRKMEQRFKIVYAQKGYLEELVRLRESQLKNVETENKCLRTKVEELTVQSQQEKK
ELEAIVLELQAQLSALTPCDSSHLTKEVSIPLVHEWAAVANNQGDVQLFRRRSFHSFEQL
SAELSFNSDSQQTDGRQNGDAAWTSAGKDNTPSMLGLCGSLASLPSSKSLASLKSSECLV
NISTEPSPALSPS
Download sequence
Identical sequences H3DBU3
99883.ENSTNIP00000017986 ENSTNIP00000017986 ENSTNIP00000017986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]