SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019481 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019481
Domain Number 1 Region: 804-1017
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.32e-76
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 669-803
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.41e-46
Family Domain of poly(ADP-ribose) polymerase 0.000000415
Further Details:      
 
Domain Number 3 Region: 527-650
Classification Level Classification E-value
Superfamily WGR domain-like 2.35e-41
Family WGR domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 8-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.96e-32
Family PARP-type zinc finger 0.0042
Further Details:      
 
Domain Number 5 Region: 110-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.2e-31
Family PARP-type zinc finger 0.0049
Further Details:      
 
Domain Number 6 Region: 394-479
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000072
Family DNA ligase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019481   Gene: ENSTNIG00000016384   Transcript: ENSTNIT00000019711
Sequence length 1021
Comment pep:novel chromosome:TETRAODON8:14:5092917:5100238:-1 gene:ENSTNIG00000016384 transcript:ENSTNIT00000019711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESQNDKLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWQ
RAAAQSTSDIDGFSSLRWEDQEKVKKAIESGGATGGGTHSKGGAKAEKTLSEFAVEYAKS
NRSTCKGCEQKIEKDQIRVSKKTIDPEKPQLGLIDRWYHTACFVSRREELLFKPEYSASQ
LKGFNTLRAEDKEELKKRLPEVKTEGKRKADQVDGVSSFAFSTQLLFVFKRNMKNMVLFS
VLLQNQSQLIWGIKDKLNKFCSVNDMKELLIANGQEVPSGESNVLDCLADGMAFGALEPC
GECRGQLVFKGDAYYCTGDISAWTKCVYKTTTPKRKDWVTPKEFHEISFLKKFKFKGQNR
IYPKEAAPQTVSAVKAEPLASASSVPVGLPEGAPPDKPLTGMKLVAVGKLSKNKDDLKAA
VEELGGKITGAANKASLCLSSKKELEKMTKKMEEVKEAGVRVVSEDFLTDIKSSGKALQE
LVSLHAISPWGAEVKVETQAQPMASKSGAMAAKSTGRVKEQEGGGKSKKMKLTVKGGAAV
DPDSGLENSAHVLEQGGKMYSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVG
TTIGGNKLDKFSDRNSAMDNFLTVYKEKTGNDWSSSNFTKYPNKFYPLEIDYGQDEEAVK
KLTATAGTKSKLAKPVQELIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYALL
TEVHQAVSDSLPEAQILDLSNRFYTLIPHDFGMKKPPLLSNLDYIQAKVQMLDNLLDIEV
AYSLLRGGAQDNENDPIDINYEKLKTKIEVIDKSAKEADIILQYVKNTHAATHNTYTLEV
QEIFKICREGEHQRYRPFEELHNRQLLWHGSRTTNYAGIMSQGLRIAPPEAPVTGYMFGK
GVYFADMVSKSANYCHTSQSEPVGLLLLAEVALGNMHELKKASHITKLPKGKHSVKGLGR
TAPDPNATVTLDGVQVPLGRGVNTNIDDTSLLYNEYIVYDVAQINLKYLLKVRFNYQTSL
W
Download sequence
Identical sequences H3DG37
ENSTNIP00000019481 99883.ENSTNIP00000019481 ENSTNIP00000019481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]