SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019800 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019800
Domain Number 1 Region: 75-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-28
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019800   Gene: ENSTNIG00000016692   Transcript: ENSTNIT00000020030
Sequence length 214
Comment pep:novel chromosome:TETRAODON8:12:9228597:9232421:1 gene:ENSTNIG00000016692 transcript:ENSTNIT00000020030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPPPKPAKPGQVKVFRAMYTFDPLTPDELYFEEGDILYISDMSDTNWWKGTCRGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECIENKVGINGLDKAGNTALYWACHGGHKD
VVELLLSQPNVELNQQNKLGDTALHAAAWKGYSDIVELLLQKNPRTDIRNNEKKLAEDMA
TNAQSASLLRRKHQCNVTRTHSNAEEYLDDDDSD
Download sequence
Identical sequences Q4RPT7
ENSTNIP00000019800 ENSTNIP00000019800 99883.ENSTNIP00000019800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]