SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020138 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020138
Domain Number 1 Region: 171-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.16e-56
Family Prokaryotic proteases 0.000000854
Further Details:      
 
Domain Number 2 Region: 382-476
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000581
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 110-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000333
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020138   Gene: ENSTNIG00000017012   Transcript: ENSTNIT00000020369
Sequence length 481
Comment pep:novel chromosome:TETRAODON8:17:11512148:11520769:1 gene:ENSTNIG00000017012 transcript:ENSTNIT00000020369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQLPSANMFWWLSLCAVAALAEAQSSGRFVVGCPARCDKSTCPRPPADCAAGQTLDACR
CCPVCASGEGEACGGTGKLGDPVCGDGLECSVPGGVAHSGTVRRRSRSGTCTCKASEPVC
GSDGVSYRNTCELRRASRRAQRLLQPPVLFVQRGACGKAQDNPDSPRHKYNFIADVVEKI
APSVVHIELFRKMTYSKREVPVASGSGFVVSEDGQIVTNAHVVANKHRVKVELQSGGSYD
AKIQDVDERSDIALIKIAAPTKLPVLLLGRSSDLRPGEFVVAIGSPFSLQNTVTTGIVST
TQRGGRELGLQNSDMDYIQTDAIINYGNSGGPLINLDGEVVGINTLKVTAGISFAIPSDK
IREFLAESYDRQSRGRTAAKKKYIGVRMMTLTPALAKELKTQHRDFPDITSGAYVMEVIA
KTPAAVGGLKEHDVIISINGQRISSASDVSAAIKKDNKLSVVVRRGNEDLILTVVPVEID
P
Download sequence
Identical sequences H3DHZ4
99883.ENSTNIP00000020138 ENSTNIP00000020138 ENSTNIP00000020138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]