SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020235 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020235
Domain Number 1 Region: 575-639,676-774
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-28
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 2 Region: 1192-1322
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-20
Family Second domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 789-904
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000215
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020235
Domain Number - Region: 1323-1422
Classification Level Classification E-value
Superfamily PH domain-like 0.00545
Family Third domain of FERM 0.062
Further Details:      
 
Domain Number - Region: 1095-1173
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00844
Family Ubiquitin-related 0.033
Further Details:      
 
Domain Number - Region: 39-174
Classification Level Classification E-value
Superfamily Tropomyosin 0.0118
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020235   Gene: ENSTNIG00000017101   Transcript: ENSTNIT00000020466
Sequence length 1470
Comment pep:novel chromosome:TETRAODON8:Un_random:95322956:95340160:-1 gene:ENSTNIG00000017101 transcript:ENSTNIT00000020466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEEAMGQEDWKDKCMVLEALLMKFRMQIIKIRDLTADKIQQLESQVVDAEKKAFTAQ
QQMQWMEEKLKVGNGQSEDSEARLFQRCQELQAAMQEKDDIIARLEQQLEEQQRQLRLQD
AKSVEEKAAKIKEWVMLKLSEFEIENAALRETNKQQDSQIEELKNQLQAFEQKCGGTGGV
QCCPGEAQRLSSLTFGCFQVKAKNPQVLTGPEPSQRSLSSLENQGQDENGKASSSQSYSC
EETQTFNVCIHHFVCFCLLAEKLKLSTFSDIHTEAQKPELTLEDNSVPETLAGKSKGSRP
MAPNSVNSEGVGAGGACKSRGSSDTYLTASDDSSSLFDFDMQHSEQPSFSLRQSSVGVMG
ECQGRGEEVHRTKMEDSDELNKRFQSQNLDSSSSSSEPNTPSPVLTPALTPKRPNPPQDL
KDNPASPKQPRLRTPASTGLVKKHLSQPPISSEATHGQTRNALSMLRPFRPVESEPDHEQ
EIVMETGIDRSQVLSNSQAALPLPLSPKINDSSAPPTPPLHRLPSWESRIYAVAKSGIRL
SDTSCSDAARKGTTDCSSYPAFVMYTSLIYKNITTPVYTSLKGKATMLSSSPFTEESSSS
GEEDSSSVCSSHTSSSSHKDSSPGSPRSLKRAVSMSSMTSESDYAIPPDAYSTDTECSEP
EQKLPKTCSTASDNGKTVSPQKSGYLLKMVKTWKKTWKRRWFVLKDGELLYFKSPSDVIK
KPQGQIEVNATSNIARGDGKQVLQIVTGKRVYYLKADSPNLLEEWLRVLHSVLRVKAASP
LFTQPDIRPSMKGLLINVKHGYSKRVWCALIGKTLYYFRSQEDKFPLGQIKLWEARIEEV
DKSKDLDDDLKACGRSLQSAPFIIAIYPQEQGPTYLLIESHHEKDSWLYHLSVAVGTTVG
KFGTEFEQLIGKLFQMDGDPTSQSWRHPILCFSKEALSSPLTTLPSQALQTEAIKLFKTC
QLFINVAIDAPAIDYHVSLAQSALQVCLTHPELQNEFFCQLIKQTHRRQPHGHPRPLQGW
QFLALCVGLFLPQHLFLWLLQVHLKRHADSRTEVGKYAIYCQRSMERTQQKGERQARPSR
MEILSILLRNPYHHSLPFSVPVHFLNNTYQVVSFDASTTVDEFQCRLNQDTGTRKGYRGF
SLYTDDPTGRDLEHCLQGDIKICDIISKWEQASKEQHRGKSENTRTVRLTYKNRLYFSHQ
VRGESERERLLLAYQTNEAIVAGHFPVNKELSLEMAALLAQVELGDFERPFSAPGSAQTK
SNQTLKQVLERFYPKHYRRATSEEQLSQLLRRLSGRWASLRGRSSSECVRIYLTVARKWP
FFGAKLFEAESITPSPEQNVRVWLAVHEDGLSVLELSSVKLLVSHPYKNVITFGGCKQDF
MLVVGQNVDTNPTKDKATVKHLFAMDASKVREITLLISSYINNAHLQKATAHHMSAPALM
AAQPISLKSKELRSKSPPALGRPSKTPTLL
Download sequence
Identical sequences H3DI91
ENSTNIP00000020235 ENSTNIP00000020235 99883.ENSTNIP00000020235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]