SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020338 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020338
Domain Number 1 Region: 300-581
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-82
Family Kelch motif 0.0000000274
Further Details:      
 
Domain Number 2 Region: 32-154
Classification Level Classification E-value
Superfamily POZ domain 1.45e-31
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020338   Gene: ENSTNIG00000017201   Transcript: ENSTNIT00000020569
Sequence length 601
Comment pep:novel chromosome:TETRAODON8:10:8986992:8991312:-1 gene:ENSTNIG00000017201 transcript:ENSTNIT00000020569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCPMRKKRPICDSDFSAIAVPSMHGSGYLDYTVETHASRSLKMMEEFRQQELLCDLVLH
VTHKDRTVDFKVHKVVLASCSQYFRAMFTSSFRECSASEVTLRDVCPLVLGRLIDFAYTS
RITVGEKCVLHLLLAAMRFQVEDVAKACCDFLTKHVEPANVIGIARFAEEIGCCELHCWC
REYINTHFSEVTKEEEFFSLSHCQLLELISQDSLKVLCESEVYKACTDWVRWDMEGRAQY
LHALLNAVHIYALPPKFLKNQLLSCPILSKANACKDFLAKIFQDMTLRKLPPAPNRGTQL
IYVAGGYRQQSLALMEAYDPRKNVWLKLSDMETPCSGLAACALFGLLYTVGGRNLTPQSN
SESNGLSCYNPMTNQWSQRASLNTPRNRVGVGVVDGCIYAVGGSQGSTHYNTVERWDPES
NRWSFVCPMSVARLGAGVTACGGFLYVVGGYDGQTRWNTAERYQPDTNAWQPLAPMSMTR
SGLGLVCMNSYLYAVGGYNGQSQLASVERYNMARNLWEPRASMHQCRSAHGVTVHQGRIY
VFGGFNQQGFLASVECYCPDKNEWTHIADMPVGRSGMGVAVTMEPCPGNLPEPEEEEGQK
E
Download sequence
Identical sequences H3DIJ4
ENSTNIP00000020338 99883.ENSTNIP00000020338 ENSTNIP00000020338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]