SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020567 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020567
Domain Number 1 Region: 1243-1308
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-21
Family TB module/8-cys domain 0.0000507
Further Details:      
 
Domain Number 2 Region: 488-554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-19
Family TB module/8-cys domain 0.00074
Further Details:      
 
Domain Number 3 Region: 851-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 4 Region: 975-1094
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 366-435
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000353
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 6 Region: 1416-1477
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000615
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 7 Region: 673-808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 8 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 9 Region: 1363-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 10 Region: 1092-1223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 11 Region: 804-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 1321-1372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1566-1609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 25-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000597
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000020567
Domain Number - Region: 225-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000545
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020567   Gene: ENSTNIG00000017426   Transcript: ENSTNIT00000020799
Sequence length 1610
Comment pep:novel chromosome:TETRAODON8:10:4914126:4971141:-1 gene:ENSTNIG00000017426 transcript:ENSTNIT00000020799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVCGGQQCCSGWALAPGTNRCIKPDCQPPCQNRGSCSRPHTCVCRSGFQGPRCEEVTPEQ
VFGSQLANPAVRTCREAADGEKKNSEICLTLLFSLSVSTPPPSSDPNYKVSYFWPALQQQ
TGTSRTVKRYPSSSAPITSNALPSNNGFTNSRSSVQNCNALSPAGANLTASLDRIKIVFT
PMRCRRVCSGNRCYNSCEKGDVTTVYSETSQQQPPKTQGFRLFFCQIPCLNGGKCIGRDQ
CWCPSNATGKFCHLPAPVPTKPTTQGHKDAGPQGQKPHSHSMYTLPLSNQQVSLHPSLVN
VHIQHPPEAEVQIHQVARVQPGQRPVITEESATEQGSRHPHTSHTSHTSHDGRNGHNGHG
SLRPHYPQSEHVGRCFQETVDGQCGKPLPGLTKQDDCCGSIGASWGLNKCHKCPTKPAYA
VISNGQVECSKGFKRLNLTHCQDINECLLPGICKNAECLNTKGSYRCLCKVGYMLDLESK
NCVSDKAVSHQKALCYRSVSAETCSLPLTQHITKQICCCSRVGKAWGAGCDRCPLPGSDH
FKEICPAGHGYTYSLSDVQISVRRLGEDGVQSTGLSWEEQSRLYPQIPSSHPSLPFGPQY
PSYPQTPQIPQYPEYLETPQVPQDPLAPQHPLYPFYPDREPLEQPQGENEKWHDGKSLPG
NPAVVTDSPLNYPGINKCALTPTICGRGECVPLQTGYTCQCEPGFKLSALQTNCIDVNEC
DTDPCEGKGRCINSYGSYTCHCHSGYSQVITQNRRFCQGEPPDINECSMPNKCQNGKCVN
TEGSYTCECNSGFAKSWRGLCEADVDECRDPRSCPNGVCVNTAGSYQCQLCSPGFRPADD
RCVDVDECLLPGVCLHGRCINLEGSYKCTCNHGYQVTPDSRSCEDIDECALPTTCPRGTC
TNTEGSFTCITCQPGFMVSEDGQQCEDIDECQTPGACFAGVCTNTEGSFSCTACDPGFTA
APDGHSCKGADVNECEDSSLCLRGWCINTVGSFSCSCPSGMELVDETTCQPVRQCEIQWD
SVEKGDCLNTEGSYMCVCPKGYVDINGRTGCQDVDECSKDNVCRRGQCLNTDGSFLCLCE
AGFKYSDETADCEDQNECEDFGSAVCGTWRCKNTIGSYLCFMGCQSGLQGEDNTDCGDID
ECANDTICGNHGFCENTNGSFLCHCDQGYTNPPGDTSRCVDVNECEMSMALCGEALCENF
DGSFLCICPNDNEEFDSSTSQCLSPANTTSKTPTQAPPSGPLQEERKECYYNLNDANFCD
NVLSRNTTKQECCCTVGAGWGDNCEIHACPIPGRDDFNKLCPHGSGLLPLTVSSVGNHWA
YIDANECEMFGSEICKNGQCSNLFSTYTCYCHSGFYYDNIRLECVDYDECAFGTACENGV
CMNTAGSFNCFCSPPLVLDSTRHHCVSLNTTEESFQNVHVDICWKRLEEDNMCSSPHQEE
RTTYAECCCLHGVAWSEQCALCPKGDSKDLAGLCNLPWRGSSDSLREQPGYEYGLEGAED
HEDTFLPPYFANYGNPAESYDIPESVPLFTDNDYSVQQPPARIPIIRPREQSPHRVDPHT
RRYDSFEGLRAEECGILNGCENGRCVRVREGYTCDCFDGYEFNLKKMACV
Download sequence
Identical sequences H3DJ72
99883.ENSTNIP00000020567 ENSTNIP00000020567 ENSTNIP00000020567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]