SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021137 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021137
Domain Number 1 Region: 164-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7e-45
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 50-102
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000000436
Family GLA-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 92-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000641
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021137
Domain Number - Region: 125-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000782
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021137   Gene: ENSTNIG00000017974   Transcript: ENSTNIT00000021370
Sequence length 421
Comment pep:novel chromosome:TETRAODON8:3:9911228:9913029:1 gene:ENSTNIG00000017974 transcript:ENSTNIT00000021370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSITSAALLCLLAGAGAVAPDRSDPQVFLDKQQASSLISRQKRNAAGSTLEQVCMENI
CTYEQARAFFQDSYRADIFWAVYVDGDQCAEKPCKNGAMCSDSVGGYDCVCKSGFTGVHC
EKDETLCVVDSDKGCSQFCKPGYTSHECSCAQGWKISGSDKTKCVPTGRFSCGRVSSVGQ
WESRMATNKENNFQGISCTSGECPWQALLKTSASPGFCSGVILKANLVLTSAQCARKYSS
FQVAVGKRSTSYEAGERTLRVKRVHVHPRFVEGRPDNDLAVVELSSSITYNKDTIAACLP
EKDFAENVLMKLPTAVTGWEEAKEEPSLQGPLMLNHLTYVSLADCLEAHPNLLTNKMGCT
LPLANANCTMGSGSPLLTVYKEVLFLTGVVSQPAGADCSKGYIVQKVSRYQSWLQSLMNL
R
Download sequence
Identical sequences H3DKT9
ENSTNIP00000021137 ENSTNIP00000021137 99883.ENSTNIP00000021137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]