SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021148 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021148
Domain Number 1 Region: 73-266
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-80
Family Sec7 domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 274-395
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-34
Family Pleckstrin-homology domain (PH domain) 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021148   Gene: ENSTNIG00000017984   Transcript: ENSTNIT00000021381
Sequence length 408
Comment pep:novel chromosome:TETRAODON8:3:9781381:9788978:-1 gene:ENSTNIG00000017984 transcript:ENSTNIT00000021381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNNLSLPQTFMSLSPSVCSPVPEDLSHDERDELSNIRRRKKELLDDIEQRLKFEIAEVMT
EIEQLTCVGESKTTQRNKQVAMGRKKFNMDPKKGIQFLQENDLLQNTPEDIAQFLYKGEG
LNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMME
AFASRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGD
LPEELLRNLYDSIKSEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTD
NCLYYFEYTTDKEPRGIIPLENLSIREVEEPRKPNCFELYNPNHKGQVIKACKTEADGRV
VEGNHVVYRISAPTPEEKEEWIKSIKASISRDPFYDMLATRKRRIASK
Download sequence
Identical sequences H3C3J4
ENSTNIP00000002813 ENSTNIP00000021148 99883.ENSTNIP00000002813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]