SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021230 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021230
Domain Number 1 Region: 31-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000735
Family Ovomucoid domain III-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021230   Gene: ENSTNIG00000018063   Transcript: ENSTNIT00000021464
Sequence length 79
Comment pep:novel chromosome:TETRAODON8:18:6171820:6172555:-1 gene:ENSTNIG00000018063 transcript:ENSTNIT00000021464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRAVFLGLLLICVTADAGKSGTLRKPSCPDSEQIMACPLNLAPVCGSDGNTYANECTL
CVERQMTKMDILIVKEESC
Download sequence
Identical sequences H3DL32
ENSTNIP00000021230 99883.ENSTNIP00000021230 ENSTNIP00000021230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]