SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021472 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021472
Domain Number 1 Region: 281-439
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-42
Family Phosphotyrosine-binding domain (PTB) 0.0034
Further Details:      
 
Domain Number 2 Region: 65-133
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000353
Family SAM (sterile alpha motif) domain 0.0067
Further Details:      
 
Domain Number 3 Region: 142-199
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000118
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021472   Gene: ENSTNIG00000018306   Transcript: ENSTNIT00000021707
Sequence length 478
Comment pep:novel chromosome:TETRAODON8:11:8917448:8935927:-1 gene:ENSTNIG00000018306 transcript:ENSTNIT00000021707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGRCGSVSNCRSAQPSMARMPSFASEWDEIEKIMNLIGAGIETPKAKQQAPSSADGACG
KALDQPVGEWLEHVGLPQYESKFLLNGFDDLRFMFFTRRENNVMEDQHLRDVGITDPGHR
KKILHAARSLPKVKALGCDGSTSLASWLDSLGLHEYLPNFLSNGYRTLECVKNLWELELV
NVIKISALGHRKRIIASLAERPYEEAPSKSRRLSPVLFHDLLSQSTSPLGQLDPYTSRSM
DMLLPLADSDRRRRALEQDCSISLRSFSERPRSVERHSDRHKESRSNLRLPSQSATYTTV
SAWHHLPEKLILDSCGYEATYLGSMIIRDLRGIESTQDACAKIRKSKDSRKGPFVILSIT
YRGVKFIDAATKTIVAEHEIRNISCAAQDPDDLCTFAYITKDLKSGHHFCHVFSTVEVTQ
TYEIILTLGQAFEVAYQVAVQSRARQFIPPSSLHSEVVETKTSRPVCPSWSSMRRSAV
Download sequence
Identical sequences H3DLS4
99883.ENSTNIP00000021472 ENSTNIP00000021472 ENSTNIP00000021472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]