SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021575 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021575
Domain Number 1 Region: 2039-2341
Classification Level Classification E-value
Superfamily BEACH domain 9.68e-122
Family BEACH domain 0.0000000141
Further Details:      
 
Domain Number 2 Region: 2454-2719
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.03e-30
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 1920-2009
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-20
Family PreBEACH PH-like domain 0.0058
Further Details:      
 
Domain Number 4 Region: 479-539,918-1040,1105-1217,1253-1319
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000142
Family Armadillo repeat 0.066
Further Details:      
 
Domain Number 5 Region: 595-627,664-758
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000619
Family Laminin G-like module 0.083
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021575
Domain Number - Region: 257-432,479-557
Classification Level Classification E-value
Superfamily ARM repeat 0.000182
Family Armadillo repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021575   Gene: ENSTNIG00000018406   Transcript: ENSTNIT00000021810
Sequence length 2751
Comment pep:novel chromosome:TETRAODON8:8:7018208:7042745:1 gene:ENSTNIG00000018406 transcript:ENSTNIT00000021810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRSGGMASKERLYELWMLYYTKKDVSYLQQWLEAFVASFERLIDVQSLEPRKLEDCSSDV
PLLPSTTHLSVVGEHSGSTPHPLLLIKFFIIVCRNMENIDTDKTPGFIFETIKLLNFCLD
QNPGCQLKMGSGDQPSLQLVVQYGLVLCESLFDPYQTWRRRLAGEEVSLLERNKYKFSPL
GLPEELPALFHECLQESQKIPAFLTLRLVHLQGAVISGGKKNGLLSITPDSVEDLFSVLR
AWCCQVSTEPKATRLPRLTLQCLTAVIHLLHSSSPAERQVEIKTILESYFQLLNWNRPLS
SDCQDKQGWEDSLISLQSQMLTAVPEILQCSDRPVLQAVFLNNNCFEHILRLIQNSKLFQ
SNRRKPEREIMCDLTTCLLTEVEVDQVWEKGVESITIHALGVLTAIMSNSPSAKEVFKER
IGYSQLFDVLKSQGQPTKRLLQELMNMAVEGEHAHVHHLGISNDQPLLLLLQWLPDLAGQ
RDLQLLVAQWLAAVCGGSLSCRTVAVEAGMVGALLQVLSQPKSLDRQCADALLGLLQELG
SLSLRPEELKGLLRLLRVDQENGAAVGKMHPYCARIVRVLSAMAAREGKDSALQYFDLTP
PMAGIMVPTVQRWPGSGFAFHAWLCLNMEFSHNRRPSVVSGAGTHHDMGKGARRKQLYSF
FTANGTGMEAFFTMEGVLVVAVCTKKDYMAVALPEYPLSDSCWHSVAIVHIPGRRPFGHN
LVTIYIDGEQRMTAQLHFPSLSEPFTSCCIGSAGHRTTTTTSPNLPISSHSNPSSPEFSF
PIHGPSLIRSQSFPASFAGGRWNSVGDPSVHTIPAGLQDSEWGTPTSLDGLLGTVFICHK
PLQPAQAKALHAAGANHVSLFKADGELSDLNSRLLLYYTPEAFKSQICHDLSPNHQYDGR
LTGHRVVNWDIKDVVNVVGGLGVLLPLLEQVCEAEPVCNGSQEISDLLGPELTSSRGPAA
MLLPLNKSSESRLERNNIAAFLLMVKNMIRHHPVNRESLLHCHGPSIIGAILSRVSGSMI
DMNVLMACQLLLEQAFNDGNSPLQQQLYQHLLFDFRIWTKSHFAVCLAHLQYLSSVINKA
KQRMKRKYGVQYVLDTIRTYYSVEKDGSPLSDEKQTIQTSLFSLLKDLLKSPTQEELHSV
LSYILAVGEEGQMVRVLDVLYELLKSSPRLEQVQTVLLDWGVEQLYGLLLNPSFGDEVRE
RVFRVLYKILKSERVSECNKQRIKLKEFGYLGPVCFLEDLPVTMTTVRCLYEQVLATDSS
PSFRDLLAVVSLSHRADLSVRLDICRKLFHLIHDNKDYVKQIAKQAGWQDVLTKLYVKES
YASHAASLVDSGTHSSLDPNYRPLLQTDQGSLSSSISNTLDSTSFRPDEEGRDYHPLSPF
DSLPFDLELGAMMDTGAHTPAGSLANTPSPLEHSKPFPPLRPRKSSSLSNVLDDSSYGKD
PSGDTISNTSNPQQTPEEELYNTLTNIIFSVLWSRSGVEGAEEAVWRERGQVFSVLTKLG
SSCQLVRPPDDIKRSLLEMMVDSSLSDLRGAQGVALPFCPSLVRLLRLLQDFLFAEGTDN
HLLWSEKIFEGVMNLLDRLKAWHSTPGSPGNTELKEMAQIGLRIITGYIKQQRSPVSEMA
YLKLHSLLQTVLCLSWEEVCFLLGQLGAHLWPGGEINDEEGEPSTTFPHLVPIVRTLLDQ
HADPITLHKLLPNLPVTNGSTTFAQDLKAFCHTVEWKSFYHQQVRPTMEQYELDTFGRSH
DIMSNFWNSCFDDLMSTAFRRDKDRSDSKSKFQQEVVVDPYLKRVKTENGRYLSWQKQSS
SQQGVVWQHWKVLRRLLTSERGAWANRVQSEVNWKLSSAETYSKMRLKLVPNYNYDPHSD
ASAQRDNMGMGADSPRSSEPLPLAVAKEAKVSDMEDDQLAEEDFNFLEDKVEGEEESQKE
KLVLSEECELITIVAVVQGRLEVTTHHIYFYDVSSDKEETEEGIGFDFKRPLSQLREVHL
RRYNLRRSALELFFIDQAHYFINFRKKVVFHFPVTQISETKIFPPQERNKVYSRILGLRP
PNLFYFGSRSPQELLKASGLTQKWVNREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLC
DYSSPILNLDDPAVFRDLSKPIGVVNPRHAQNVREKYESFEDPTGTIDKFHYGTHYSNAA
GVMHYMIRMEPFTTLHIQLQSGRFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPE
FLENMNSFDLGRLQISQDHVADVLLPRWATSREDFIRKHMKALESEHVSSHLHEWIDLIF
GYKQRGEEAVKALNVFYYCTYEGAVDLDAIANETERKALEGIISNFGQTPCQLLKEAHPA
RMSAENAVRRQARLDTVPLNIFEQLTKLRPFVEVVSDGLPLIQAVVPKNQTRSFIIQGSD
ILVTVSSNGLIGTHSWLPYDKNIANYFTFTKGPHHVQSQRRTQRFLNGPFSPGVEMSARV
LVVSNDGRLLFSGGHWDCSLRVTQLGKGKLVGRICRHIDVVTCLALDLCGIYLISGSRDT
SCIVWKVLQQGGFSSGLSPRPVQVLCGHDQEVTCVAISTELDMAVSGSKDGTVIVHTIRR
GQFLRSLRPPVESSVPAQISELHVGMEGHIVVQTSLEECSHRKGKYSVHVYSVNGRLLSS
FTTEEQVTALHLVSEHVILGTVRGSLHIRDLYSLDALVAPLALKVPVRSVSVTKECSHIL
VGLEDGKLIVVGAGKPEEVRLGQFSRRLWGSTRRISQVSSGETEYNPTEIA
Download sequence
Identical sequences H3DM27
ENSTNIP00000021575 99883.ENSTNIP00000021575 ENSTNIP00000021575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]