SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021848 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021848
Domain Number 1 Region: 14-97,136-401,486-544,572-585
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-31
Family LacY-like proton/sugar symporter 0.031
Further Details:      
 
Domain Number 2 Region: 408-460
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000804
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021848   Gene: ENSTNIG00000018672   Transcript: ENSTNIT00000022084
Sequence length 606
Comment pep:novel chromosome:TETRAODON8:Un_random:9801642:9806108:-1 gene:ENSTNIG00000018672 transcript:ENSTNIT00000022084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRARGLLDNIQLFVLCHGLLQLSQLLYSAYFKSIITTIERRYGLSSYSAGSLSSLNEISN
SALIVFVSYFGDQVHRPRLIGVGGLLMAVSATVLTLPHFLSQPYEYDSVLHNQRDLCNMH
TNQSEPTCGREESRQMDENQNLWLLMASAQLLFGVGSVPIQPFGLSYIDDFAGPGNSALY
IAILFSVSVFGPAVGYLLGSVVLQFYVDLDKAALGAQQELHQGDPRWVGAWWMGLLITTG
FLILTSVPYFFFPRSMPSKHGVRQTQAVRRKSDTRRPERSVQAHLKRFPRMLLHLLLNPL
FLLLVLAQCCFSSVIAGLSTFLNKFLEQQFGASAAYSSLLVGALNLPAVAVGMLLGGVIM
KRVGLTLKTIPRFSVVMLTTSLLLCVPLFFMGCHTHEVMEVNHLQGSLCSTNCSCLKSAF
NPVCGSDAAEYISPCHAGCTNFTKDPNNSHRVQLYTQCTCVGGSQSQARPGPCPNSCPQF
LIPAILVISLAALIASITHNPLYMMVLRSVASEEKSFAIGIQFLLMRVLAWLPAPALFGM
VIDTSCIWWKQVCGKKYSCGYYDNITLRNRYMGLQVSYKMAGILLLMVLGWKAQRTQEYC
LEKGHC
Download sequence
Identical sequences H3DMV0
ENSTNIP00000021848 ENSTNIP00000021848 99883.ENSTNIP00000021848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]