SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022004 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022004
Domain Number 1 Region: 67-260
Classification Level Classification E-value
Superfamily Sec7 domain 5.89e-71
Family Sec7 domain 0.0000000706
Further Details:      
 
Domain Number 2 Region: 268-387
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-33
Family Pleckstrin-homology domain (PH domain) 0.00000397
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022004
Domain Number - Region: 17-57,270-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family BAR domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022004   Gene: ENSTNIG00000018820   Transcript: ENSTNIT00000022240
Sequence length 405
Comment pep:novel chromosome:TETRAODON8:18:10414451:10417948:1 gene:ENSTNIG00000018820 transcript:ENSTNIT00000022240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQGLDGAFPSDLCGDYQQQMEKLEMENIKMYKKDLLDDIQKLKLEIDKVEWRKYAIFEFT
ESASKITEKSKLFSSGKKKFNMEPRKGISYLVENKLLDERAPAIAEFLYKEEGLNKTAIG
EFLGEREELHLQTLKAFVDLHEFSDLNLVQALSRQFLWSFRLPGEAQKIDRMMEAFATRY
CDCNANVFQSSDTCYILSFAIIMLNTSLHNPCVKDKTTLERFISMNRGINNGGDLPDELL
SKLYESIHSEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYF
EFTTDKEPRGIIPLENLCVREVPYPRKPFCLELYNPNCPRQKIKACKTETDGRVVEGKHQ
SYTISAPSAEERDSWIDAIRASITKDPFYDLVSVRKKKVINTTPE
Download sequence
Identical sequences H3DNA5
ENSTNIP00000022004 99883.ENSTNIP00000022004 ENSTNIP00000022004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]