SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022743 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022743
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-38
Family Galectin (animal S-lectin) 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022743   Gene: ENSTNIG00000019519   Transcript: ENSTNIT00000022983
Sequence length 135
Comment pep:novel chromosome:TETRAODON8:Un_random:6106494:6107304:-1 gene:ENSTNIG00000019519 transcript:ENSTNIT00000022983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQLLELKNVRLRTGDQLKIKGFVLKDADRFRINLGSDEENLALHFNPRFSDTTDESVLV
FNSRKAGSWGEERKESPNPLHRGRDAKIVLKLAGDVFKVELPDGHKFIFPNRENVDVISY
IGIGGDFKLTSFKIC
Download sequence
Identical sequences H3DQE4
99883.ENSTNIP00000022743 ENSTNIP00000022743 ENSTNIP00000022743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]