SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022975 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022975
Domain Number 1 Region: 3-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-68
Family Ankyrin repeat 0.00000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022975   Gene: ENSTNIG00000019727   Transcript: ENSTNIT00000023217
Sequence length 341
Comment pep:novel chromosome:TETRAODON8:Un_random:105270318:105272315:-1 gene:ENSTNIG00000019727 transcript:ENSTNIT00000023217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLQAYHGHAQALEVLLQGETDVDQRDEAGRTSLALAALRGHIECVHTLLSQGASPHTAD
SQHGRTPVHLAVMNGHTSCVRLLLDDSDGADLTDAADSQGQTPLMLAVVGGHVDAVSLLL
EREASVNVSNKHGFTALHLGECIQCLLEQEASVLLGDSQGRTAIHLAAARGHASWLSELL
NIACAEASSLPVLRDLGGYTPLHWACYYGHEGCVEVLLEQKGCRCIDGNPFTPLHCAVGN
NHEPCASLLLEAMGSDIVGCRDAKGRTPLHAAAFAGHVDCIHLLLSHDAPVDAVDQSGFT
PLMMAAEKGRDGALEVLLTSSSANLGLTDKDGNTALHLACS
Download sequence
Identical sequences Q4RAH9
ENSTNIP00000022975 99883.ENSTNIP00000022975 ENSTNIP00000022975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]