SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000634 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000634
Domain Number 1 Region: 88-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-53
Family SPRY domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily RING/U-box 1.28e-17
Family RING finger domain, C3HC4 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000634   Gene: ENSTBEG00000000746   Transcript: ENSTBET00000000730
Sequence length 271
Comment pep:novel scaffold:TREESHREW:scaffold_109193:43006:43821:1 gene:ENSTBEG00000000746 transcript:ENSTBET00000000730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSLQAEATCPICLDVFFNPVSLSCAHIFCWDCIQNWQLERGDSKLICPMCRGESEKPP
VEEWQIRSLALLIKQHGPLMEQSLHLSDELLKFREDMTLDADTANSFLILSNDLRSVHYR
NICQRRRKNPRRFTYLACVLGTPSFSFGRHYWEVEVGEGKEWALGVCKESVNRKKRKNDL
TPEHGYWVIIMKAGVIHTNAILARRIPVSSGLSRVGIFLDVEMEELKFFDVRNDAFICIY
TCFYTSEPLRPFFCPELPGEAGSGAPLTICS
Download sequence
Identical sequences ENSTBEP00000000634 ENSTBEP00000000634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]