SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001134 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001134
Domain Number 1 Region: 281-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-38
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-19
Family RING finger domain, C3HC4 0.0033
Further Details:      
 
Domain Number 3 Region: 75-132
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001134   Gene: ENSTBEG00000001326   Transcript: ENSTBET00000001310
Sequence length 477
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_991:15661:67897:1 gene:ENSTBEG00000001326 transcript:ENSTBET00000001310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLRQELSCPLCLQLFDAPVTTECGHSFCRACLGRVAGEPAADGTAPCPCCQAPT
RPQALSTNQQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLL
PAAEAHTRLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK
YCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKMFRALMPAMEELTFDQSSAHP
SLVVSPTGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQLLSNGEHYWEVEVGDKPRWALG
VMAAEASRRGRLHPVPSQGLWLLGLRDGKVLEAHVEAKEPRALRASEGRAQRIGLYLSFS
DGVLSFYDASNADALELLFAFHERLPGPVYPFFDVCWHDKGKNAQPLLLVGPDGEVV
Download sequence
Identical sequences ENSTBEP00000001134 ENSTBEP00000001134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]