SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001549 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001549
Domain Number 1 Region: 306-488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-67
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 90-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-19
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 5-79
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000134
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001549   Gene: ENSTBEG00000001779   Transcript: ENSTBET00000001783
Sequence length 510
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5694:49486:92080:-1 gene:ENSTBEG00000001779 transcript:ENSTBET00000001783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGAAESNVSCPQCPEFP
QRHMRPNRHLANVTQLVRQLRSERSGPGGEVGVCEKHREPLKLYCEEDQMPICVMCARSR
EHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXDIGDTLSXXXXXXXXXXXXXXXXXXXXXHIFAQKCLFLTARLKQFTEKMQSDM
EKIQELREAQLYSVDVTLDPDTAYPSLVLSDNLRQVRYSFLQQDLPDNPERFNLFPCVLG
SPCFVAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTS
PMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGK
SAPLVICPMSGIDGFSGQVGNQGHSMETSP
Download sequence
Identical sequences ENSTBEP00000001549 ENSTBEP00000001549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]