SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000001831 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000001831
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 6.09e-21
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 2 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-19
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 3 Region: 440-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-16
Family SPRY domain 0.0015
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000001831
Domain Number - Region: 384-422
Classification Level Classification E-value
Superfamily ARM repeat 0.0019
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000001831   Gene: ENSTBEG00000002099   Transcript: ENSTBET00000002110
Sequence length 536
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5686:62534:93859:-1 gene:ENSTBEG00000002099 transcript:ENSTBET00000002110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTSDIRPISGGRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVAREPREAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAILVEKAAQPHREKILNHLSTLRRDRDKIQSFQAKGEADILAALKQ
LQDQRQFIAAEFEQGHQFLREREQHLLDQLARLEQELTEGREKYTARGVGELSRLALVIS
ELEVKAQQPAAELMQDTRDFLNRYPRKKFWIGKPIARVVKKKTGEFSDKLVSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYSNLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAAYGDGYDDWETDEDEESLG
EEEEEEEEEEEEVLESCMLVARDSVKRKGDLSLRPEGGVWSLRLSSSGIWANTSPEAELL
PALRPRRVGIRLDEECTVTFTNAESQLIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences ENSTBEP00000001831 ENSTBEP00000001831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]