SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000002593 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000002593
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 1.65e-37
Family EF-hand modules in multidomain proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 1.49e-30
Family EF-hand modules in multidomain proteins 0.0052
Further Details:      
 
Domain Number 3 Region: 219-297
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-21
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000002593   Gene: ENSTBEG00000002985   Transcript: ENSTBET00000003002
Sequence length 739
Comment pep:novel scaffold:TREESHREW:scaffold_144874:99399:253596:-1 gene:ENSTBEG00000002985 transcript:ENSTBET00000003002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVARLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKIT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHILPPRPVTSMNDTLFSHSVPSSGSPFIT
RSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNPSCM
LESSNRLDEEHRLIARYAARLAAESSSSQQAQQRTAPDISFTIDANKQQRQLIAELENKN
REILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELM
VQLEGLMKLLKXXXXXXXXXXXXHTISRPIPMPIRSASACSTPTHTPQDSLGVGGDVQEA
FAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFARTQFEDLVPSPT
SEKTFLAQIHARKPGYIHGGATTSTMRSDLVTEDGDSYVRPEDENYENDSVRQLENELKM
EEYLKQKLQDEAYQVSLQG
Download sequence
Identical sequences ENSTBEP00000002593 ENSTBEP00000002593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]