SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003054 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003054
Domain Number 1 Region: 293-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-39
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-24
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 90-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003054   Gene: ENSTBEG00000003531   Transcript: ENSTBET00000003521
Sequence length 476
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6103:13705:26766:-1 gene:ENSTBEG00000003531 transcript:ENSTBET00000003521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAFLTNVKEEVTCPICLELLREPQSLECGHSFCQSCITANHTKPTVGQEESCCPVCRV
SYQPGSLRPNRHLANIVERLREVNLSQEEGQKVDCCARHGEKLLLFCKKDGKVICWLCER
SQEHRNHQTFLLEEVAKEYQEKLRVTLDELMKKQQTTEKWKADIHEERTSWKARGDXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPIFFIFRNKKLILNKPKTFPKQKKVFRAPDLRGMLQVFKELTDAQCYWAEM
TFSTKNLVNIIMSMDQTQLKYKNKWTKFFIFVNKDDGILGELYITSGRHYWEVDVSKKRA
WILGVRMKSYLKPTMMSGMQDEKYQPQYGYWVIGLQNRSEYKVYEDPSILTLSLTVPPCR
VGVFVDYEAGTVSFFNVTNHGFLIYKFSACDFSEGVFPYFNPCQCEVPMVLCSPGS
Download sequence
Identical sequences ENSTBEP00000003054 ENSTBEP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]