SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003393 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003393
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-50
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000138
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000144
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000003393
Domain Number - Region: 108-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000636
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003393   Gene: ENSTBEG00000003906   Transcript: ENSTBET00000003906
Sequence length 667
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_907:48236:185459:-1 gene:ENSTBEG00000003906 transcript:ENSTBET00000003906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFDDPLLLPCAHSLCFNCAHRILVSHCATNEAVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences ENSTBEP00000003393 ENSTBEP00000003393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]