SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000003836 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000003836
Domain Number 1 Region: 280-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-64
Family SPRY domain 0.00000636
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-22
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 82-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000214
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000003836   Gene: ENSTBEG00000004453   Transcript: ENSTBET00000004446
Sequence length 466
Comment pep:novel scaffold:TREESHREW:scaffold_109287:31227:44197:-1 gene:ENSTBEG00000004453 transcript:ENSTBET00000004446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAADDLKGKLEKSLEHLRKQMEDALLFQAQAEETCALWQAVMVESQRQNVL
GEFERLRRLLAEEEQQLLQKLEEEELEVLPRLREGAARLGQQSAQLAELIDELEGRCQLP
ALGLLQDIKDALCRVQDVKLQPPEVVPMELRTVCKVPGLVETLRRFRGDVTLDPDTANPE
LVLSEDRKSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVC
RENVNRKEKGELSAGNGFWILVFLGSYYNSPERAFAPLRDPPRRVGIFLDYEAGHLSFYS
ATDGSLLFIFPETPFSGTLRPLFSPLSSSPTPMTICRPKGGPGDAQ
Download sequence
Identical sequences ENSTBEP00000003836 ENSTBEP00000003836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]