SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004190 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004190
Domain Number 1 Region: 275-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-66
Family SPRY domain 0.00000835
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-16
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004190   Gene: ENSTBEG00000004872   Transcript: ENSTBET00000004862
Sequence length 466
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4784:100576:106993:1 gene:ENSTBEG00000004872 transcript:ENSTBET00000004862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTADLMENLREELTCFTCLDYFTSPVTTECGHSFCLACLRSWEEHNTPFSCPECWRTLE
VPHFQPNERLGRLASIGRQLRCQVQQSEDEQGSYGRMPAATKVFDDEQGMIAFSSQSHGV
SRVYLSSETEEHHKEKLQEILNLLRKKKKEAQTILTHEKERVILCKEETKTCKQVVVSEY
MKMHQFLKEEEQLQLQLLDKEERQNMKKLRDNETQLTQQIRSLSKMIGQIESTCQNSISE
SFEEVRGALERSQPLLLQCPEATTTELSLCHITGMREMLRKFSTDITLDADTANAYLVLS
EDLKSVRYGGSRQQLPDNPERFDLSATVLGAQVFTGGRHYWEVDVGNKTEWEVGICKDSV
SRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVHKVGIFLDYELGHIAFYN
VTDESLIYSFPPTSFQEALRPIFSPCLPNEGTNTEPLTVCSLKSHA
Download sequence
Identical sequences ENSTBEP00000004190 ENSTBEP00000004190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]