SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004300 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004300
Domain Number 1 Region: 121-213
Classification Level Classification E-value
Superfamily EF-hand 1.96e-31
Family EF-hand modules in multidomain proteins 0.0022
Further Details:      
 
Domain Number 2 Region: 196-277
Classification Level Classification E-value
Superfamily RING/U-box 1.02e-19
Family ZZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004300
Domain Number - Region: 2-27
Classification Level Classification E-value
Superfamily EF-hand 0.000966
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004300   Gene: ENSTBEG00000004990   Transcript: ENSTBET00000004995
Sequence length 601
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2642:37013:327900:-1 gene:ENSTBEG00000004990 transcript:ENSTBET00000004995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQNFDVIRLSTYRTACKLRFVQKRCNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRGKLTVFSVKAMLATMCGGK
MLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQKK
IMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHN
YQLCQNCFWRGHASGPHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPFPEQP
EKPLLAHIVPPRPLTNMNDTMVSHVSSGVPTPTKRLLYSKDAPSHLADEHALIASYVARL
QHCARVLESPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELEN
KNREILQEIQRLRLEHEQASQPTLEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRE
LMVQLEGLMKLLKXXXXXXXXXATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSL
SGVGGDVQEAFAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEGAEEDEEKMQNGKD
R
Download sequence
Identical sequences ENSTBEP00000004300 ENSTBEP00000004300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]