SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004328 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004328
Domain Number 1 Region: 317-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-37
Family SPRY domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 31-103
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-17
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004328
Domain Number - Region: 109-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000143
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004328   Gene: ENSTBEG00000005033   Transcript: ENSTBET00000005026
Sequence length 494
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5157:4107:54969:1 gene:ENSTBEG00000005033 transcript:ENSTBET00000005026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPTPSSDISPGNYVEVNDSPTHIPSKVVIQDITMELHCPLCNDWFRDPLMLGCGHNFCQ
ACIQSFWKLHAKETFCPECKMICQYSNCTFNLVLEKLVEKIKKLPLLKGQPQCPEHGENL
KLFSKPDGKLVCFQCKDARLSVEQSKEFLKISDAVHFFTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKEMLVSIQARMEQQNSFDFLKDITALLDSLEKGINALAPRELISKKLNPGQF
KGPIQYMIWKEMHSTLSPGQSPLTLDPKITHLYLVPFKDTSMWHGDIKQVMPNDPERVDS
SVAMLNLKGFTFRKYGAVAKKKKWTVAVIRESIIRKGSCPLTPEQGFWLLRLRNQTDLKA
LDLPSCSLKLSNNLDKVGIYLDYEGGQVSFYNAKTMTHIYTFSSTFMEKLYPYFCPCLND
GGENKEPLHIVHPQ
Download sequence
Identical sequences ENSTBEP00000004328 ENSTBEP00000004328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]