SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004956 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004956
Domain Number 1 Region: 3075-3198
Classification Level Classification E-value
Superfamily EF-hand 9.81e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 3200-3296
Classification Level Classification E-value
Superfamily EF-hand 7.25e-38
Family EF-hand modules in multidomain proteins 0.00000457
Further Details:      
 
Domain Number 3 Region: 8-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.86e-34
Family Calponin-homology domain, CH-domain 0.0000156
Further Details:      
 
Domain Number 4 Region: 2057-2205
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-23
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 3276-3364
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 2741-2868
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 7 Region: 335-441
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-17
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 2456-2569
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-17
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 9 Region: 2891-3029
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 10 Region: 1516-1671
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-16
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 1625-1769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000749
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 12 Region: 773-896
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 2201-2317
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000187
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 14 Region: 518-657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000275
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 15 Region: 1820-1963
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000229
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 16 Region: 1100-1199
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000072
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 17 Region: 2666-2758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000259
Family Spectrin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000004956
Domain Number - Region: 981-1042
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1306-1366
Classification Level Classification E-value
Superfamily Spectrin repeat 0.024
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004956   Gene: ENSTBEG00000005582   Transcript: ENSTBET00000005755
Sequence length 3674
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5603:57382:2499263:-1 gene:ENSTBEG00000005582 transcript:ENSTBET00000005755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWWEEVEDCYEREDVQKKTFTKWINAQFSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPKEKGSTRVHALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQNVINFTTSWSDLALNALIHSHXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVATTYPDKKSILMYITSLFQVLPQQ
VSIEAIQEVEMLPRPSKVTREEHFQLHHQMHYSQQITVSLAQGYEPTSSSPKPRFKSYAY
TQAAYVTTSDPTRSSFPSQHSEAAEEKSFGSSLMETEVNLDSYQTALEEVLSWLLSAEDT
LQAQGEISNDVEEVKEQFHTHEGYMMDLTSHQGRVGNVLQLGSQLIGTGKLSEDEETEVQ
EQMNLLNSRWECLRVASMEKQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVLQEDLEQEQVRVNSLTHMVVVVDESSGDYATAALEEQLKXXXXXXX
XXXXXXXXRWILLPDILLWQRFTEEQCLFSTWLSEKEDAVNKIHTTGFKDQNEMLSSLQK
LAVLKTDLEKKKQTMDKLCSLNQDLSTLKNKSVTQKMEAWLENFAQRWDNLVQKLEKSSA
QISQAVTTTQPSLTQTTVMETVTMVTTREQILVKHGQEEVSPPPPQKKRQIIVDSEIRKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIEREKAEKFRKLQDASRS
AQALVEQMVNEGINADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLE
QMTTTAENWLKTQPTATSDPTAIKSQLKICKDEVNRLSALQPQIERLKIQSVALKEKGQG
PMFLDADFVAFTNHFNQVFVDVQAKEKELQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXALQSSLQEQESGLNYLSTTVKEMSKKAPSEISRKYQSEFE
EMEGRWKKLSSQLVEHCQKLDDQMNKLRKIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLLVNDIQTIQPSLNSVNEGGQKIKHEAEPEFASRLEAELRELNAQWDYVCQ
QVYDRKEALKGGLDKTISLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLENLMQHSEDNPNQI
RILAQTLTDGGVMDELINEELETFNSRWRELHEEDVRRQKLLEQSIQSAQEIEKSLHLIQ
ESLEVIDKQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKRNQGKEAAQRVLSQ
IDAAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERK
QQLEKCLKLSRKMRKEMNALTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQKEIEK
QKVHLKSITDLGEALKAVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMET
FDQNVDHITKWIIQADTLLDESEKKKPQQREDVLKHLKAELNDIRPKVDSTRDQAAHLMA
NRGDHCRKVVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQ
GVNLKEEDFNKDMSEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQHLLQTKHNALKD
LRSQRRKKALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKIKEIDRELQKKK
DELNAVRRQAEGLSEDGAAMAVEPIQIQLSKRWREIESKFAQFRRLNFAQIRTVREETVI
VTTEDMPLEISYVPSTYLTEITYASQALSEVEQLLSAPDLCAKDFEDLFKQEESLKNIKD
NLQQISGRIDIIHNKKMAAMQSATPVEKVKLQEALSQLDFQWEKVNKIYKDRQGQFDRSV
EKWRRFHYDMKIFNQWLTEAEQFLKKTQTPESWEHAKYKWYLKELQDGIRQRQTVVRTLN
ATGEEIIQQSSKTDANILQEKLGGLNLRWQEVCKQLAERKKRLEEQKNILSEFQRDLNEF
VLWLEEADNITRIPLEPGNEQQLKEKLEHVKLLAEELPLRQGILKQLNETGGTVLVSAPI
SPEEQDKLENKLKQTNLQWIKVSKTLPEKQGEIEARIKDLGQLEEQLNHLLLWLSPIRNQ
LEIYNQPNQTGPFDIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXPSQTVTLVTQPVVTKETAIFKVEMPSSLLLEVP
ALADFNRAWTELTDWLSLLDRVLKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEEL
ITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKE
EAEQVIGQARAKLDSWKEGPYTMDTIQKKITETKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVSEREAALEETHRLLQQFPLDLEKFLAWLTEAET
TANVLQDATHKERLLEDSKGVRELMKQWQDLQGEIEAHTDIYHNLDENGQKILRSLEGSD
DAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSR
QAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRE
LPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSTDWQRKIDEALEKLQELQEATDELDLKL
RQAEVIKGAWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLS
PYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSXXXXXXXXXXXXXXXX
XXXXXHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAAC
DALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGR
TGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGE
VASFGGSNIEPSVRSSFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQ
AKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVR
DFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETXXXXXXXXXXXXXPASSPQLSH
DDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRS
PAQLISLESEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQAEAKVNGTTV
SSPSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSR
GRNTPGKPMREDTM
Download sequence
Identical sequences ENSTBEP00000004956 ENSTBEP00000004956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]