SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005160 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005160
Domain Number 1 Region: 295-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-40
Family SPRY domain 0.000088
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily RING/U-box 1.28e-24
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 91-143
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000763
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005160   Gene: ENSTBEG00000005986   Transcript: ENSTBET00000005996
Sequence length 488
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6153:187770:203508:-1 gene:ENSTBEG00000005986 transcript:ENSTBET00000005996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAILVDVKEEVTCPICLELLTEPQSLDCGHSFCQSCLIENQTKSTVGQEGENCCPMCR
VSYQPGNLRTNRHLANIAERLRKANVSLEEGQRVHHCARHGEKLLLFCKEDGKAICLLCE
RSQEHRGHQTFLIEEVAQEYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDR
QSAQAEFKILREMLDSEEQKVLQKLEKEERNILLGLEESENELAQQSQSMRDLISDLEYR
LKGSKMEMLQSFFFFFVPRCETVTLKKPNTFPKEQRRVSPSSSLMLILKEYKELTDVQRY
WVHVTMTPINNANILISNDGRQVRYQSAFGLQSFTFEDNCPYNGILGVPGITSGKHYWEV
DVSNKRAWILGVCLKTCVSFFGKPNLVQCASYLPKNGYWVIGLQDRSESKDFKRHFSVPL
LLTPSLTVPLCRIGVFVDYEAGTVSFFNATNHGFLIYKFSASSFSQEIFPYFNPMRCEFP
MTLCSPFS
Download sequence
Identical sequences ENSTBEP00000005160 ENSTBEP00000005160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]