SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005330 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005330
Domain Number 1 Region: 321-415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000111
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 522-566
Classification Level Classification E-value
Superfamily RING/U-box 0.0000147
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005330   Gene: ENSTBEG00000006188   Transcript: ENSTBET00000006190
Sequence length 575
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_646:341379:381918:1 gene:ENSTBEG00000006188 transcript:ENSTBET00000006190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLASRSLGQGLLLTLEEHIARFLGTRGATTTMGNSCICRDDSGAEDSVDAQQ
QQAENSALPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLELEILAVXXXXXXXDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLKEGRQLTYEKVDLSSIGAMLNSNDVSEYLKISPHGLARCDASSFESVRCTFCVDAGVW
YYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHLHPC
WKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRRLALLKQVSIRENCCSLCCDEVADTQLKP
CGHSDLCMDCALQLETCPLCRKEIVSRVRQISHIS
Download sequence
Identical sequences ENSTBEP00000005330 ENSTBEP00000005330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]