SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000005544 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000005544
Domain Number 1 Region: 288-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-42
Family SPRY domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 5.98e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 83-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.92e-17
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000005544   Gene: ENSTBEG00000006429   Transcript: ENSTBET00000006437
Sequence length 488
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6153:215844:264900:1 gene:ENSTBEG00000006429 transcript:ENSTBET00000006437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPVNIKEVTCPICLLLTEPLSLDCGHSFCQACITAKNKESVVCPRLERSCPVCQTRYQP
GNLRPNWYLAHIVEKVKEVKRSPWKHQKRELCVHHGEKLQIFCKEDGKVICWRCELSPEH
RGHQTFTIDKVVKECQEKLQAAIQRLRREHQKAEKLETDLGEERSSWKSYIQTERQKILK
GFNEMRSILDSEEQRELQKLEEEEVNVLDNLAAAKDQLGQQKQCVRELITDLLRRTQGTP
VEMLQDVIDVMKRSESWTLKKPKAVSKKLKHVFRAPDLSRMLQVFKELRDVQCHWVDVML
NPVNTVSNVVISADQRVKVVHACMFDSDPREFSAFGVLGCQYFSSGRYYWEVDVSGKAWI
LGVHSKRNKLNKTKSFCGVDFDPAHQMVCSRNNPQNGYWVIGLQNEFEYNAFEYSSSSSK
ILTLSMSVLPHRVGVFLDCEAGIVSFFNVTNQGSLIYKFSKCCFSQPTYPYFNPWNCPGP
MTLCPPST
Download sequence
Identical sequences ENSTBEP00000005544 ENSTBEP00000005544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]