SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009478 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009478
Domain Number 1 Region: 299-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-36
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-21
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 94-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000148
Family B-box zinc-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009478   Gene: ENSTBEG00000010969   Transcript: ENSTBET00000010961
Sequence length 494
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5970:156881:180614:-1 gene:ENSTBEG00000010969 transcript:ENSTBET00000010961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGPAASPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQTAPTCPVC
KDRASPADLRTNHTLNNLVEKLLREEAEGARWAGHRSPRLCRLHRGQLSLFCLDDKELLC
CSCQADPRHQGHRVQPAKDTAHDFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRQKQLLAEEKMKQLTEETEALAHEIE
RLQMEMKEDDVSFLMXXXXXXXXLFCTMEPEPVQPGMLIEVCKYLDSLQFRVWKKMVMCV
ESVPFSFDPNSAAGWLSVSDDLTSVTNHGYRMQVENPERFSSAPCLLGSCVFSQGSHVWE
VVLGGLQSWRVGVVRVRQDAGAEAHSHSCYHDTRSGFWYLCRTQGVDGDQCMTSDPATAP
LVLPVPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGTRGDGPPEALC
ICPLRITIKEELDS
Download sequence
Identical sequences ENSTBEP00000009478 ENSTBEP00000009478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]