SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010641 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010641
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-24
Family Pyrin domain, PYD 0.0029
Further Details:      
 
Domain Number 2 Region: 360-424
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-17
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 721-767
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000475
Family SPRY domain 0.0007
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000010641
Domain Number - Region: 291-352
Classification Level Classification E-value
Superfamily RING/U-box 0.0166
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010641   Gene: ENSTBEG00000012283   Transcript: ENSTBET00000012286
Sequence length 774
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_85:31566:46996:-1 gene:ENSTBEG00000012283 transcript:ENSTBET00000012286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLSDSLLFTLEELVPYDFEKFKFKLQNTSLEKEHSRIPRGQLQTARPVKLASLLVTH
YGEEYAVRLTLQVLRGINQRLLAEELDRVISQEYLTQDGGGTDSSAVSCSSGENKQKSLK
IVDGPRGDGAASLLCSQLEAGKGSQKKTQSKRREQKVLEGLDAQGKPWPKNAALLSRRSP
TLGKPQGEKESLVSASLRRNASSAGRLQGLANGSLGRKEARKLEVDLPSGKKRPKSLELT
ISPGEKELPGSKALLTLQDTRSAGPDLVATPREPRAGVARTIVALEKGSKNLEHSVWRRP
PDEAACSLCHAQEGDPAGGTCMHNSCSCPITSGDPETSGSHSTICLRCQASLAKGSPRDL
SPQPLPQCQRHMKQVQLLFCEDDREPICLICRLSQEHRGHQVRPIEEAALEYKEQIQKQL
EHLKELRKSGEEQRAQGDKNMANFLRQTETQKQRIRCQLEQLCRFLEQQEQLFVSWLGEL
GQTISQAREKYGARVSRDIALLDKLIGELEAKQGQPEWELVQDVGVTLHXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XISFYNVTARSHIYTFTGFSFSGPLQPIFSPGTHDGGKNTGSLSICTVGSHGSH
Download sequence
Identical sequences ENSTBEP00000010641 ENSTBEP00000010641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]