SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011522 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011522
Domain Number 1 Region: 6-169
Classification Level Classification E-value
Superfamily EF-hand 7.8e-49
Family Calmodulin-like 0.000000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011522   Gene: ENSTBEG00000013310   Transcript: ENSTBET00000013303
Sequence length 205
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_599:187008:211596:-1 gene:ENSTBEG00000013310 transcript:ENSTBET00000013303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILAARMGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNF
FPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGY
ISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDDELLPSEREKERER
ACNGERKQASRKPLPALTLHTPRPF
Download sequence
Identical sequences ENSTBEP00000011522 ENSTBEP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]