SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000000076 from Tupaia belangeri 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000000076
Domain Number 1 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 544-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 461-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 139-190
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000112
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000000076
Domain Number - Region: 37-118
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000000076   Gene: ENSTBEG00000000091   Transcript: ENSTBET00000000091
Sequence length 615
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3456:84517:145573:1 gene:ENSTBEG00000000091 transcript:ENSTBET00000000091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEWDMDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQ
ASQLLNLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWVLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLM
SLDAEGPVPKPEAPAQAEPREEPCVWEQRHPEEREIPVDPDTGAEPLVPAQDTSSQVKRE
EALCARGQRGLEDRAIPTESITDSPISAQDLLSRIKQEEQQCVWDQQDLAEREIPTDPNS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPYSCPECGKSFGVRKSLIIH
HRSHTKERPYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLH
TGERPFQCALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGP
GLGAPRPLQAPPERD
Download sequence
Identical sequences ENSTBEP00000000076 ENSTBEP00000000076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]